Syngnathus scovelli (Gulf pipefish): 125975454 Help Entry 125975454         CDS       T08785                                  Name (RefSeq) protein S100-A1   KO K17274   protein S100-A10 Organism sscv  Syngnathus scovelli (Gulf pipefish) Pathway sscv04382   Cornified envelope formation sscv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sscv00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     125975454  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125975454  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sscv04147]     125975454 Exosome [BR:sscv04147]  Exosomal proteins   Exosomal proteins of microglial cells    125975454 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  125975454 NCBI-ProteinID:  XP_049587012 LinkDB All DBs Position 9:complement(2771066..2772707) Genome browser AA seq 98 aa AA seqDB search MSDLEKCMENLIVIFHRYAKDDGDGRTLSKKELKKLLETELPTFLKTQKNPKTVDCILQD LDHNKDDKLDFEEFLPLVAGLSLACEKCYVLHQKKGKQ NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctgatttggagaaatgcatggagaacctcattgtcatcttccaccgctacgccaaa gatgatggtgatggcaggactctgagcaaaaaagaactgaagaaacttctggagacggag ttgcccaccttcctcaagactcaaaagaaccccaaaacagtggattgcatcttgcaggac ctggaccacaacaaagatgacaagttagactttgaagagtttctccccttggtcgcaggc ctctccttggcctgtgagaagtgctacgtgctgcaccagaagaagggcaaacagtaa

DBGET integrated database retrieval system