Syngnathus scovelli (Gulf pipefish): 125975808 Help Entry 125975808         CDS       T08785                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism sscv  Syngnathus scovelli (Gulf pipefish) Pathway sscv04010   MAPK signaling pathway sscv04144   Endocytosis sscv04370   VEGF signaling pathway sscv04510   Focal adhesion sscv04520   Adherens junction sscv04530   Tight junction sscv04810   Regulation of actin cytoskeleton sscv04912   GnRH signaling pathway sscv05100   Bacterial invasion of epithelial cells sscv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sscv00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     125975808 (cdc42l)    04370 VEGF signaling pathway     125975808 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     125975808 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     125975808 (cdc42l)    04520 Adherens junction     125975808 (cdc42l)    04530 Tight junction     125975808 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     125975808 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     125975808 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125975808 (cdc42l)    05100 Bacterial invasion of epithelial cells     125975808 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sscv04131]     125975808 (cdc42l)    03036 Chromosome and associated proteins [BR:sscv03036]     125975808 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sscv04147]     125975808 (cdc42l)    04031 GTP-binding proteins [BR:sscv04031]     125975808 (cdc42l) Membrane trafficking [BR:sscv04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     125975808 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     125975808 (cdc42l)   Macropinocytosis    Ras GTPases     125975808 (cdc42l) Chromosome and associated proteins [BR:sscv03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     125975808 (cdc42l) Exosome [BR:sscv04147]  Exosomal proteins   Exosomal proteins of microglial cells    125975808 (cdc42l)   Exosomal proteins of breast milk    125975808 (cdc42l) GTP-binding proteins [BR:sscv04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     125975808 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  125975808 NCBI-ProteinID:  XP_049587780 LinkDB All DBs Position 9:complement(11776736..11780055) Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR EDSNTIEKLAKNKQRPLYPESAEKLGRELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTKRKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgtgtagttgtcggggatggtgcggtaggaaagacctgcttactc atctcctacacgaccaacaagttcccctcagaatatgtgcctacggtttttgacaactat gcagtgactgtgatgatcgggggcgagccttacacactaggcctttttgacacagcaggt caggaggactatgacaggctgcgtcctctcagctacccacagacagacgtgttccttgtc tgcttctctgtcgtgtccccatcatcatttgaaaatgtcaaggagaagtgggttcctgag atttcccaccactgcccacgcacgcctttcttgctggtgggaactcaggtggacctgcgg gaggacagcaacaccattgagaagctggccaagaacaaacaacgccccctgtaccccgag agcgccgagaagttgggccgggaactcagagccgttaaatacgtcgagtgctctgctctc acacagcgaggcctcaagaacgtgtttgacgaggccatcctggccgccttggagcccccc gagaccaaaaccaagaggaagtgcgtcctgctatag

DBGET integrated database retrieval system