Syngnathus scovelli (Gulf pipefish): 125975827 Help Entry 125975827         CDS       T08785                                  Symbol atg12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism sscv  Syngnathus scovelli (Gulf pipefish) Pathway sscv04068   FoxO signaling pathway sscv04136   Autophagy - other sscv04140   Autophagy - animal sscv04621   NOD-like receptor signaling pathway sscv04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:sscv00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     125975827 (atg12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     125975827 (atg12)    04136 Autophagy - other     125975827 (atg12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     125975827 (atg12)    04622 RIG-I-like receptor signaling pathway     125975827 (atg12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sscv04131]     125975827 (atg12)    04121 Ubiquitin system [BR:sscv04121]     125975827 (atg12)    03029 Mitochondrial biogenesis [BR:sscv03029]     125975827 (atg12) Membrane trafficking [BR:sscv04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     125975827 (atg12) Ubiquitin system [BR:sscv04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    125975827 (atg12) Mitochondrial biogenesis [BR:sscv03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     125975827 (atg12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 XendoU Motif Other DBs NCBI-GeneID:  125975827 NCBI-ProteinID:  XP_049587805 LinkDB All DBs Position 9:complement(11425881..11427418) Genome browser AA seq 117 aa AA seqDB search MSDNADSPTETPKEELHSPPEDSTTNEEKKKIDVLLKAVGDTPIMKTKKWAVDRSRTVQS LSQFIARFLKMDANEQLFIYVNQSFAPSPDQEVGILFDCFGSDSKLVLHYCKSQAWG NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgtctgacaatgcggactcaccaacagagaccccgaaagaggagctacactcacctccc gaagattcgacgactaacgaagagaaaaaaaagattgatgtcctgctgaaggcagttggg gacacccccattatgaaaaccaagaaatgggccgtggacaggagcaggacggtgcagtca ctttctcagtttatcgctcgcttcctcaagatggatgccaacgaacaactgttcatctac gttaaccagtcgtttgcgccctcaccggaccaagaagtggggatcctctttgactgtttt ggaagtgacagcaaactggttctgcattattgtaaatctcaagcttggggttga

DBGET integrated database retrieval system