Syngnathus scovelli (Gulf pipefish): 125976790 Help Entry 125976790         CDS       T08785                                  Symbol rab7a Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism sscv  Syngnathus scovelli (Gulf pipefish) Pathway sscv04137   Mitophagy - animal sscv04140   Autophagy - animal sscv04144   Endocytosis sscv04145   Phagosome sscv04148   Efferocytosis sscv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sscv00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     125976790 (rab7a)    04145 Phagosome     125976790 (rab7a)    04140 Autophagy - animal     125976790 (rab7a)    04137 Mitophagy - animal     125976790 (rab7a)    04148 Efferocytosis     125976790 (rab7a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125976790 (rab7a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sscv04131]     125976790 (rab7a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sscv04147]     125976790 (rab7a)    04031 GTP-binding proteins [BR:sscv04031]     125976790 (rab7a) Membrane trafficking [BR:sscv04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     125976790 (rab7a) Exosome [BR:sscv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125976790 (rab7a)   Exosomal proteins of other body fluids (saliva and urine)    125976790 (rab7a)   Exosomal proteins of colorectal cancer cells    125976790 (rab7a)   Exosomal proteins of bladder cancer cells    125976790 (rab7a) GTP-binding proteins [BR:sscv04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     125976790 (rab7a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  125976790 NCBI-ProteinID:  XP_049588635 LinkDB All DBs Position 11:complement(6636698..6640692) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttcaaggaagaaagtcctcctcaaagtcatcatcctcggagactccggagttggg aagacctcgttgatgaaccagtatgtgaataagaagttcagtaaccagtacaaggccacg ataggtgcagacttcttgacgaaagaagtcatggtggatgacagactggtcaccatgcag atttgggacacagcaggtcaggagaggttccagtctttaggggtggcgttctaccgcgga gccgactgctgcgttctggtctttgacgtgacggccccaaacaccttcaagaccctcgat agctggagggacgagttcctgatccaggccagcccccgagacccggagaatttccccttt gtggtgctcggcaacaagatcgacctagagaacagacaggtcacaaccaagcgggcacaa gcatggtgtcagagcaagaacaacatcccctattttgaaaccagcgccaaggaggccatc aacgtagagcaggccttccagacgatcgcacgcaacgctctcaaacaggagaccgaggtg gagttgtacaacgagttcccggagccgattaagctggacaggaacgagcgagccaagcct tcggcggagacctgcagctgctga

DBGET integrated database retrieval system