Syngnathus scovelli (Gulf pipefish): 125977175 Help Entry 125977175         CDS       T08785                                  Symbol cenps Name (RefSeq) centromere protein S   KO K11511   centromere protein S Organism sscv  Syngnathus scovelli (Gulf pipefish) Pathway sscv03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:sscv00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     125977175 (cenps)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sscv03036]     125977175 (cenps)    03400 DNA repair and recombination proteins [BR:sscv03400]     125977175 (cenps) Chromosome and associated proteins [BR:sscv03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      125977175 (cenps) DNA repair and recombination proteins [BR:sscv03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      125977175 (cenps) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Bromo_TP TFIID-31kDa Histone Serine_rich Luteo_PO Motif Other DBs NCBI-GeneID:  125977175 NCBI-ProteinID:  XP_049589430 LinkDB All DBs Position 11:12046498..12047534 Genome browser AA seq 112 aa AA seqDB search MSESEDETRQRLKAAVHYTVGRMCHKIGEDHRREFSRQVVAAITETAFRQCDIFAKDLEA FAKHAKRCTVSAEDVKLLARRSTALSIHIQRKSEEVEKEQKALKMKKKSKDS NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgtccgagagcgaagacgaaacgcgtcagcgactaaaggccgccgtacattatacggtc ggtcggatgtgtcacaaaatcggtgaggaccaccgcagagagtttagccgacaagtcgta gcggcgataaccgagacagccttcagacaatgtgatatatttgctaaagacttggaagcg tttgcaaaacatgctaaaagatgcactgtgtcagcagaggatgtcaaacttttggcccgt cgcagcacagcattgtcgatacacatacagaggaaaagcgaagaagtggaaaaagagcag aaggctttgaaaatgaagaagaagagcaaagactcttaa

DBGET integrated database retrieval system