Syngnathus scovelli (Gulf pipefish): 125984800 Help Entry 125984800         CDS       T08785                                  Symbol h2bk1 Name (RefSeq) histone H2B type 2-K1   KO K11252   histone H2B Organism sscv  Syngnathus scovelli (Gulf pipefish) Brite KEGG Orthology (KO) [BR:sscv00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:sscv03036]     125984800 (h2bk1)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sscv04147]     125984800 (h2bk1) Chromosome and associated proteins [BR:sscv03036]  Eukaryotic type   Nucleosome assembly factors    Histones     125984800 (h2bk1) Exosome [BR:sscv04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    125984800 (h2bk1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-W LonB_AAA-LID CENP-T_C Motif Other DBs NCBI-GeneID:  125984800 NCBI-ProteinID:  XP_049602967 LinkDB All DBs Position 17:5880593..5881170 Genome browser AA seq 116 aa AA seqDB search MSDDLSKRRGKISGEKRAKKKVKRKETYAMYIYKVLKQVHPDTGISSRAMSIMNSFVNDL FERIATEASRLAQYNKRATITSREVQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgtctgatgatctttcaaagaggagaggcaagatttccggtgagaaaagggccaagaaa aaggtcaaacgtaaagagacgtacgccatgtacatctacaaagttttgaaacaggttcat cccgacacgggaatttccagccgagccatgagcatcatgaattcgttcgtcaacgacctg ttcgaaagaatcgccaccgaggcgtcgcgtttggctcagtacaacaaacgcgccaccatc accagccgcgaggtgcagaccgccgtccggctgctgctgcccggcgagctggccaagcac gccgtgtccgagggcaccaaggcggtcacaaagtacaccagttccaaatga

DBGET integrated database retrieval system