Syngnathus scovelli (Gulf pipefish): 125985991 Help Entry 125985991         CDS       T08785                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism sscv  Syngnathus scovelli (Gulf pipefish) Pathway sscv04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:sscv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     125985991  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sscv04121]     125985991    03400 DNA repair and recombination proteins [BR:sscv03400]     125985991 Ubiquitin system [BR:sscv04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      125985991    Cul5 complex      125985991 DNA repair and recombination proteins [BR:sscv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      125985991 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  125985991 NCBI-ProteinID:  XP_049605296 LinkDB All DBs Position 18:complement(3455895..3457325) Genome browser AA seq 112 aa AA seqDB search MDGEERTYGGCEGPEAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggtgaagaaaggacctatggcggctgtgaaggaccagaagccatgtatgtgaaa ttgatatcttcagatggccatgagttcattgtgaaaagagaacatgcgttgacgtcgggg acgatcaaggctatgctgagtggtccaggtcaatttgccgagaatgaaaccaatgaagtc aacttcagggagattccctctcatgtcctctccaaggtctgcatgtacttcacttacaag gtccgctacaccaacagctccacggaaatccctgaattccccatcgctcctgagattgca ttggaactgctcatggcagctaatttcctggattgctaa

DBGET integrated database retrieval system