Syngnathus scovelli (Gulf pipefish): 125987308 Help Entry 125987308         CDS       T08785                                  Symbol s100a10a Name (RefSeq) protein S100-A10a   KO K17274   protein S100-A10 Organism sscv  Syngnathus scovelli (Gulf pipefish) Pathway sscv04382   Cornified envelope formation sscv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sscv00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     125987308 (s100a10a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125987308 (s100a10a)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sscv04147]     125987308 (s100a10a) Exosome [BR:sscv04147]  Exosomal proteins   Exosomal proteins of microglial cells    125987308 (s100a10a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EH DREV Motif Other DBs NCBI-GeneID:  125987308 NCBI-ProteinID:  XP_049607585 LinkDB All DBs Position 19:complement(5246056..5247349) Genome browser AA seq 100 aa AA seqDB search MPSELETAMESLIVVFHRYASRDGRNGTLSRQELRLLMENELSNFLKSQRDPAAVDKIMK DLDTNGDGQVDFEEFVSLVVGLSVACERCYQLRMKNETRK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggagacagctatggagtccctcattgtggtgttccaccgctacgcc tcgcgggacggcaggaacggcaccctcagccgacaagagctccgtttgctgatggagaac gagctgtccaactttttaaagtcccagagggacccggctgccgtggacaagatcatgaag gacctggacaccaacggggacggccaggtggactttgaagaatttgtgtccctagtggtg ggactgtccgttgcatgcgagcggtgctatcagttgcgcatgaaaaatgagaccaggaag tga

DBGET integrated database retrieval system