Syngnathus scovelli (Gulf pipefish): 125988480 Help Entry 125988480         CDS       T08785                                  Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism sscv  Syngnathus scovelli (Gulf pipefish) Pathway sscv04814   Motor proteins sscv05132   Salmonella infection Brite KEGG Orthology (KO) [BR:sscv00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     125988480  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     125988480  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:sscv03037]     125988480    04812 Cytoskeleton proteins [BR:sscv04812]     125988480 Cilium and associated proteins [BR:sscv03037]  Motile cilia and associated proteins   Dynein arm    125988480 Cytoskeleton proteins [BR:sscv04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      125988480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 MPN_2A_DUB_like Motif Other DBs NCBI-GeneID:  125988480 NCBI-ProteinID:  XP_049609720 LinkDB All DBs Position 2:2274515..2276274 Genome browser AA seq 112 aa AA seqDB search MDEYHNEGSFNSEEADNIVKECIETVVGGDDYNQNLVNKWTSAIVERCLIQLVKLGKQYK FIVTCSLMQKTGAGLHTANSCYWDTTTDGSSTVRWESRTMYCVVSVFAVAIA NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggacgaatatcataacgagggctcattcaactccgaagaagctgataacattgtcaaa gagtgtattgagactgttgtgggcggtgatgactacaaccagaatctggtaaacaaatgg acctctgctatcgtagagcgctgcctcatacaactggtcaaactgggaaaacagtataaa tttatcgttacatgctccctgatgcagaaaactggtgctggcctccacacggcaaactcc tgctactgggacacaaccacggacggtagctccacggtgagatgggaaagccgcaccatg tactgcgtggtcagcgtgtttgccgttgcaatcgcgtag

DBGET integrated database retrieval system