Syngnathus scovelli (Gulf pipefish): 125991042 Help Entry 125991042         CDS       T08785                                  Name (RefSeq) elongin-B   KO K03873   elongin-B Organism sscv  Syngnathus scovelli (Gulf pipefish) Pathway sscv04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:sscv00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     125991042  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:sscv04121]     125991042    03400 DNA repair and recombination proteins [BR:sscv03400]     125991042 Ubiquitin system [BR:sscv04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      125991042    Cul5 complex      125991042 DNA repair and recombination proteins [BR:sscv03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      125991042 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  125991042 NCBI-ProteinID:  XP_049614499 LinkDB All DBs Position 21:8574939..8577318 Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDQLLEDSKTLGDS GFTNQTARPQAPATVGLAFRVNDEMFEQLHIEAFSSPPELPDVMKPQDSGSTANEQSVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcttaatgatccggcgtcacaagaccaccattttcacagacgccaaggag tccaccacagtgtatgagctaaagcgaatcgttgaaggaattttaaagagaccacctgag gaccagcggctctacaaagacgaccagttgctggaggacagcaaaactctgggagacagc ggattcaccaaccagactgccagaccacaagcaccggctactgtgggtctggcttttcga gtcaatgatgagatgtttgagcagctgcacatcgaggccttctccagccccccagagctc cccgatgtgatgaagcctcaggactccggtagcacggccaatgaacaatccgtgcagtga

DBGET integrated database retrieval system