Staphylococcus schleiferi 2317-03: RN70_08155 Help Entry RN70_08155        CDS       T04520                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sscz  Staphylococcus schleiferi 2317-03 Pathway sscz00998   Biosynthesis of various antibiotics sscz01100   Metabolic pathways sscz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sscz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RN70_08155    00074 Mycolic acid biosynthesis     RN70_08155   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RN70_08155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 DUF7080 Ribosomal_L12_N HLH Motif Other DBs NCBI-ProteinID:  AKS73871 UniProt:  A0A0K1AEB0 LinkDB All DBs Position complement(1729480..1729713) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEGASFKEDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVNYINTLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagtaaaagacatcattgttgatcgtttaggcgtagacgctgat aaagtaactgaaggtgcatctttcaaagaagatttaggtgcagattcacttgatattgct gaattagtgatggaattagaggatgaatttggtactgaaattccagatgaagaagcggaa aaaatcaacacagttggagacgctgttaattacattaatacacttgaaaaataa

DBGET integrated database retrieval system