Shewanella sediminis: Ssed_0325 Help Entry Ssed_0325         CDS       T00596                                  Name (GenBank) acyl carrier protein, putative   KO K02078   acyl carrier protein Organism sse  Shewanella sediminis Pathway sse01100   Metabolic pathways sse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sse00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Ssed_0325    00074 Mycolic acid biosynthesis     Ssed_0325   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Ssed_0325 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ABV34938 UniProt:  A8FQ15 LinkDB All DBs Position complement(377472..377726) Genome browser AA seq 84 aa AA seqDB search MSLHNEIKQLIIDCLDLEDVSIDDIETDAALFGEGLGLDSIDALELGLAIKKRFDVKIEA NSEATKAHFYSVANLASFIESQRA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgagcttacacaacgaaataaaacaattaatcatagattgcttagatcttgaagacgtc agcatcgatgatattgaaactgatgcggcgctatttggagaaggcttagggctggactca atcgatgcgctggaactaggcctagcgattaaaaagcgattcgatgtgaaaatcgaagcg aactctgaagccactaaagcacatttttatagcgtggccaacttggctagctttattgaa tcgcagcgagcttag

DBGET integrated database retrieval system