KEGG   Shewanella sediminis: Ssed_4025
Entry
Ssed_4025         CDS       T00596                                 
Name
(GenBank) single-strand binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
sse  Shewanella sediminis
Pathway
sse03030  DNA replication
sse03430  Mismatch repair
sse03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sse00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Ssed_4025
   03430 Mismatch repair
    Ssed_4025
   03440 Homologous recombination
    Ssed_4025
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:sse03032]
    Ssed_4025
   03400 DNA repair and recombination proteins [BR:sse03400]
    Ssed_4025
   03029 Mitochondrial biogenesis [BR:sse03029]
    Ssed_4025
DNA replication proteins [BR:sse03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Ssed_4025
DNA repair and recombination proteins [BR:sse03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     Ssed_4025
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    Ssed_4025
Mitochondrial biogenesis [BR:sse03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    Ssed_4025
SSDB
Motif
Pfam: SSB SSB_1 tRNA_anti-codon DUF2457
Other DBs
NCBI-ProteinID: ABV38629
UniProt: A8G0K6
LinkDB
Position
complement(4930999..4931694)
AA seq 231 aa
MASRGVNKVILVGNLGKDPEVRYMPNGNAVANFTVATSESWKDQQGQPQERTEWHNIVMY
RRLAEIAGEYLKKGSKVYIEGKLQTSKWQDQSTGQDRYKTEINANEMQMLDSRGQGGGQQ
GGYGQQQGQQQQNQYNAPQQQAPQQGYAPKPQQAPQQAPQQGYAPKPQQAQQQAPAQQSA
YAPKPQQAPQQAPQQAAPQQRPAPQPQQPAQQPQQNFTPDLDDGWDDDIPF
NT seq 696 nt   +upstreamnt  +downstreamnt
atggccagtcgtggtgtcaataaggtaattttggtcggtaacttagggaaagaccctgaa
gttcgttacatgccaaatggcaatgccgtagccaactttacagtggcgacgagtgagtct
tggaaagaccaacaaggtcagccacaagagcgtacagagtggcataatatcgttatgtat
cgtcgcttagcagaaattgcaggcgagtaccttaagaaaggttctaaggtatatatcgaa
ggtaaattgcaaaccagcaagtggcaggatcagtctaccggtcaagatcgctacaagaca
gagatcaatgctaacgaaatgcagatgctcgatagccgtggtcaaggtggcggacagcaa
ggtggctatggtcaacagcagggtcagcaacagcagaaccagtacaatgcacctcagcag
caggctccgcagcaaggttatgcacctaagccgcagcaagcccctcagcaggctccacag
caaggttatgcacctaagccgcagcaagcacaacagcaagctcctgcacagcaatcagct
tatgcgccaaagcctcagcaagcaccacagcaagcaccacagcaagcggctccgcaacag
cgtccagcgcctcagcctcaacagccagcgcagcagcctcagcagaacttcactcctgac
ctggatgatggttgggatgatgatatcccgttttag

DBGET integrated database retrieval system