Shewanella sedimentimangrovi: JYB85_17600 Help Entry JYB85_17600       CDS       T07846                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssem  Shewanella sedimentimangrovi Pathway ssem01100   Metabolic pathways ssem01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssem00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JYB85_17600    00074 Mycolic acid biosynthesis     JYB85_17600   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JYB85_17600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Motif Other DBs NCBI-ProteinID:  QSX37046 LinkDB All DBs Position 3947567..3947815 Genome browser AA seq 82 aa AA seqDB search MQNREQILEMLTGILVDEFEIDAAAITPEASLYQDLDLDSIDAVDLVIKLQQLTGKKIQP DEFKSVRTVDDVINAIEGLVKA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcagaatcgcgaacaaattctggaaatgctcacgggcatattggtagacgaattcgaa atcgacgctgcggctatcacacccgaagcctccctgtatcaggatctggatctggacagc atagacgcggtggatttggtcattaagctgcaacagctgaccggcaaaaaaatccaaccg gacgaattcaaatccgtccgtactgtcgatgacgtaatcaatgccatcgaaggcttggtt aaagcctga

DBGET integrated database retrieval system