Solea senegalensis (Senegalese sole): 122765763 Help Entry 122765763         CDS       T07721                                  Symbol elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism ssen  Solea senegalensis (Senegalese sole) Pathway ssen04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ssen00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     122765763 (elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ssen04121]     122765763 (elob)    03400 DNA repair and recombination proteins [BR:ssen03400]     122765763 (elob) Ubiquitin system [BR:ssen04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      122765763 (elob)    Cul5 complex      122765763 (elob) DNA repair and recombination proteins [BR:ssen03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      122765763 (elob) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  122765763 NCBI-ProteinID:  XP_043876105 LinkDB All DBs Position LG3:complement(20452763..20457516) Genome browser AA seq 119 aa AA seqDB search MDVFLMIRRHKATIFTDAKESTTVYELKRIVEGILKRPPEDQRLYKDDVLLNDSQTLGNC GFTNQTARPQAPATVGLAFRLGDDSFEQLRIEPFSTPPELPDVMKPQDSGSTANEQAVQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatgtgtttcttatgatcagacgtcacaaggcgaccatcttcacagatgccaaagag tccaccacagtatatgagctgaagcgcattgtggaaggcattttaaagagaccacctgaa gatcagaggctttataaggatgacgtgctgcttaacgacagtcaaacgcttggaaactgt ggcttcacaaatcaaacagcccgacctcaggccccggctacagtgggattagcttttcgt ctgggtgatgattcatttgagcagctgaggatcgagcctttctccaccccccctgagctt cctgacgtcatgaagccccaggactcgggcagcacagccaacgagcaggctgttcagtga

DBGET integrated database retrieval system