Solea senegalensis (Senegalese sole): 122770904 Help Entry 122770904         CDS       T07721                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism ssen  Solea senegalensis (Senegalese sole) Pathway ssen03030   DNA replication ssen03410   Base excision repair ssen03420   Nucleotide excision repair ssen03430   Mismatch repair ssen03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ssen00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     122770904 (pold4)    03410 Base excision repair     122770904 (pold4)    03420 Nucleotide excision repair     122770904 (pold4)    03430 Mismatch repair     122770904 (pold4)    03440 Homologous recombination     122770904 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ssen03032]     122770904 (pold4)    03400 DNA repair and recombination proteins [BR:ssen03400]     122770904 (pold4) DNA replication proteins [BR:ssen03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     122770904 (pold4) DNA repair and recombination proteins [BR:ssen03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       122770904 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      122770904 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  122770904 NCBI-ProteinID:  XP_043884048 LinkDB All DBs Position LG6:1483971..1487431 Genome browser AA seq 111 aa AA seqDB search MTTKRGLITDSFKVVKKGRRGGKRQKQRATPPPSPQQESDSEAVREDELHKLRQFDLDWR FGPCTGISRLQRWERAKLHGLDPPEEIRELLLLQTHTDPEYTLSLWREYPL NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atgacgaccaagcgtggactgataacggattcgttcaaggtggtgaagaaaggaaggaga ggtggcaaacggcagaagcaacgggcgacgcctcctccttctcctcaacaagagtctgac agtgaagcggtcagagaggacgagctgcacaagctcagacagtttgatctggactggagg ttcgggccgtgcacagggatcagcaggctgcagaggtgggagagagcaaagcttcatggt ctggatccacctgaggagatcagagagctgctgctgctgcagacacacactgaccccgag tacacgctgagcctgtggagagagtatccactgtga

DBGET integrated database retrieval system