Solea senegalensis (Senegalese sole): 122771506 Help Entry 122771506         CDS       T07721                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism ssen  Solea senegalensis (Senegalese sole) Brite KEGG Orthology (KO) [BR:ssen00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:ssen03041]     122771506 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssen04052]     122771506 (ubl5) Spliceosome [BR:ssen03041]  Complex B   Other components    Complex B specific factors     122771506 (ubl5) Cytokines and neuropeptides [BR:ssen04052]  Neuropeptides   Unclassified    122771506 (ubl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Ubiquitin_4 OTU1_UBXL Motif Other DBs NCBI-GeneID:  122771506 NCBI-ProteinID:  XP_043885055 LinkDB All DBs Position LG6:20192607..20195893 Genome browser AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRHEKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtctgcaacgatcgtctgggcaagaaagtccgggtcaagtgcaactct gaggatactattggagatctgaagaagctcattgctgcccagacaggaacacgacacgag aagattgttttaaagaaatggtataccatattcaaagatcacgtgtctctgggtgactat gaaatccatgatgggatgaacctggaactgtactaccagtag

DBGET integrated database retrieval system