Solea senegalensis (Senegalese sole): 122775048 Help Entry 122775048         CDS       T07721                                  Symbol cdc42l Name (RefSeq) cell division cycle 42, like   KO K04393   cell division control protein 42 Organism ssen  Solea senegalensis (Senegalese sole) Pathway ssen04010   MAPK signaling pathway ssen04144   Endocytosis ssen04370   VEGF signaling pathway ssen04510   Focal adhesion ssen04520   Adherens junction ssen04530   Tight junction ssen04810   Regulation of actin cytoskeleton ssen04912   GnRH signaling pathway ssen05100   Bacterial invasion of epithelial cells ssen05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ssen00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122775048 (cdc42l)    04370 VEGF signaling pathway     122775048 (cdc42l)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122775048 (cdc42l)   09144 Cellular community - eukaryotes    04510 Focal adhesion     122775048 (cdc42l)    04520 Adherens junction     122775048 (cdc42l)    04530 Tight junction     122775048 (cdc42l)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122775048 (cdc42l)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     122775048 (cdc42l)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122775048 (cdc42l)    05100 Bacterial invasion of epithelial cells     122775048 (cdc42l)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssen04131]     122775048 (cdc42l)    03036 Chromosome and associated proteins [BR:ssen03036]     122775048 (cdc42l)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssen04147]     122775048 (cdc42l)    04031 GTP-binding proteins [BR:ssen04031]     122775048 (cdc42l) Membrane trafficking [BR:ssen04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     122775048 (cdc42l)  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     122775048 (cdc42l)   Macropinocytosis    Ras GTPases     122775048 (cdc42l) Chromosome and associated proteins [BR:ssen03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     122775048 (cdc42l) Exosome [BR:ssen04147]  Exosomal proteins   Exosomal proteins of microglial cells    122775048 (cdc42l)   Exosomal proteins of breast milk    122775048 (cdc42l) GTP-binding proteins [BR:ssen04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     122775048 (cdc42l) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  122775048 NCBI-ProteinID:  XP_043890669 LinkDB All DBs Position LG9:21747613..21753835 Genome browser AA seq 191 aa AA seqDB search MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEISHHCPRTPFLLVGTQVDLR EDSNTVEKLAKNKQRPLYPESGEKLARELRAVKYVECSALTQRGLKNVFDEAILAALEPP ETKTRKKCVLL NT seq 576 nt NT seq  +upstreamnt  +downstreamnt atgcagactataaaatgtgtagttgtaggagacggtgcagtaggaaagacctgcttactg atctcatacacgaccaacaagttcccctcagaatatgtgcctacggtttttgacaattat gcagtgacagtgatgattgggggagagccctatacactcggcctttttgacacagcaggt caggaggattatgacaggctgcgtcctctcagttatccacagacagatgtgttccttgtg tgtttctctgtcgtctccccctcatcatttgaaaatgtcaaagagaagtgggttcctgag atttctcaccactgcccacgcacacccttcctgttggtgggcacacaggtggatctgcgg gaagacagcaacacggttgagaagctggcaaagaacaaacagcggcctctatatcctgag agtggagagaaactggctcgtgagctcagggctgtcaaatatgtggagtgctctgctctt acacagcgagggcttaagaatgtgtttgacgaggccatcctggcagccttggagcctcca gagaccaaaaccaggaaaaagtgcgttctgctatag

DBGET integrated database retrieval system