Solea senegalensis (Senegalese sole): 122775636 Help Entry 122775636         CDS       T07721                                  Symbol rheb Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism ssen  Solea senegalensis (Senegalese sole) Pathway ssen04140   Autophagy - animal ssen04150   mTOR signaling pathway ssen04218   Cellular senescence ssen04910   Insulin signaling pathway ssen05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:ssen00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     122775636 (rheb)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122775636 (rheb)   09143 Cell growth and death    04218 Cellular senescence     122775636 (rheb)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     122775636 (rheb)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     122775636 (rheb)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:ssen04031]     122775636 (rheb) GTP-binding proteins [BR:ssen04031]  Small (monomeric) G-proteins   Ras Family    Rheb     122775636 (rheb) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SRPRB RsgA_GTPase AAA_14 Reovirus_M2 RhoGAP_pG1_pG2 STIV_penton_2nd ParE_toxin YebF Motif Other DBs NCBI-GeneID:  122775636 NCBI-ProteinID:  XP_043891631 LinkDB All DBs Position LG1:42187820..42194313 Genome browser AA seq 184 aa AA seqDB search MPQPKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKMITINGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSNKSFEVVQVIHEKLLDMVGKVQVPIMLVGNK NDLHMERVISCEEGKALADSWNAAFMESSAKENQTAVEVFRRMILEAEKMDGGVQPGKTS CSMM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagcccaagtcacggaaaatcgccatcctcgggtacagatccgtaggaaagtcg tctttgacaattcagtttgtggaaggccagtttgtcgactcctatgatccaacaatagaa aacacttttaccaaaatgatcacaataaatggacaagagtaccatcttcagctggtggac acagcaggacaggatgagtactctatcttcccacagacttactccatagatatcaatggt tacattctggtttattcagtcacatctaataaaagctttgaagttgtacaagttatccat gaaaaactgttggacatggtggggaaagttcaagtaccaattatgctcgtcgggaacaag aatgacctacatatggagcgtgtaatcagttgtgaggagggtaaagcattggccgattcc tggaacgctgccttcatggagtcctcggctaaagagaaccagacggcggtggaagttttc cggaggatgatcctggaggcagagaagatggatggcggtgtgcagccgggaaagacatcc tgctccatgatgtag

DBGET integrated database retrieval system