Solea senegalensis (Senegalese sole): 122775945 Help Entry 122775945         CDS       T07721                                  Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism ssen  Solea senegalensis (Senegalese sole) Pathway ssen04010   MAPK signaling pathway ssen04012   ErbB signaling pathway ssen04068   FoxO signaling pathway ssen04137   Mitophagy - animal ssen04140   Autophagy - animal ssen04144   Endocytosis ssen04150   mTOR signaling pathway ssen04210   Apoptosis ssen04218   Cellular senescence ssen04370   VEGF signaling pathway ssen04371   Apelin signaling pathway ssen04510   Focal adhesion ssen04540   Gap junction ssen04625   C-type lectin receptor signaling pathway ssen04810   Regulation of actin cytoskeleton ssen04910   Insulin signaling pathway ssen04912   GnRH signaling pathway ssen04916   Melanogenesis ssen05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ssen00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122775945    04012 ErbB signaling pathway     122775945    04370 VEGF signaling pathway     122775945    04371 Apelin signaling pathway     122775945    04068 FoxO signaling pathway     122775945    04150 mTOR signaling pathway     122775945  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     122775945    04140 Autophagy - animal     122775945    04137 Mitophagy - animal     122775945   09143 Cell growth and death    04210 Apoptosis     122775945    04218 Cellular senescence     122775945   09144 Cellular community - eukaryotes    04510 Focal adhesion     122775945    04540 Gap junction     122775945   09142 Cell motility    04810 Regulation of actin cytoskeleton     122775945  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122775945   09152 Endocrine system    04910 Insulin signaling pathway     122775945    04912 GnRH signaling pathway     122775945    04916 Melanogenesis     122775945  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122775945  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssen04131]     122775945   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssen04147]     122775945    04031 GTP-binding proteins [BR:ssen04031]     122775945 Membrane trafficking [BR:ssen04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     122775945  Endocytosis   Macropinocytosis    Ras GTPases     122775945 Exosome [BR:ssen04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    122775945   Exosomal proteins of colorectal cancer cells    122775945 GTP-binding proteins [BR:ssen04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122775945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  122775945 NCBI-ProteinID:  XP_043892133 LinkDB All DBs Position LG10:19562884..19579856 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagagtataagctggtggtggtgggagctggaggcgtgggcaagagtgcactcacc atccagctcatccagaaccactttgtggatgaatatgaccccaccatagaggactcgtac agaaaacaggtggtgattgacggggagacgtgcctgctggacatcctggacactgcaggt caggaggagtacagcgccatgagggaccagtacatgagaacaggggagggtttcctctgt gtctttgccatcaacaacaccaaatcatttgaagacattcaccagtacagagaacagata aaacgtgtgaaggactcagacgatgttcccatggtgcttgtgggaaacaagtgtgacctc ccagcacgtacggtggacacgaggcaagcccaggaacttgctcgctcctacggcatcccg tacatcgagacgtctgccaagacacgacagggagtggaggatgccttctacacactggtt agggagattagacagcataaactgaggaagctgaacccacctgatgaaagcggtcaggac tgtatgagctgtcgctgtgtggtatcgtga

DBGET integrated database retrieval system