Solea senegalensis (Senegalese sole): 122778620 Help Entry 122778620         CDS       T07721                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism ssen  Solea senegalensis (Senegalese sole) Pathway ssen04020   Calcium signaling pathway ssen04070   Phosphatidylinositol signaling system ssen04114   Oocyte meiosis ssen04218   Cellular senescence ssen04261   Adrenergic signaling in cardiomyocytes ssen04270   Vascular smooth muscle contraction ssen04371   Apelin signaling pathway ssen04625   C-type lectin receptor signaling pathway ssen04744   Phototransduction ssen04910   Insulin signaling pathway ssen04912   GnRH signaling pathway ssen04916   Melanogenesis Brite KEGG Orthology (KO) [BR:ssen00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     122778620    04020 Calcium signaling pathway     122778620    04070 Phosphatidylinositol signaling system     122778620  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     122778620    04218 Cellular senescence     122778620  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122778620   09152 Endocrine system    04910 Insulin signaling pathway     122778620    04912 GnRH signaling pathway     122778620    04916 Melanogenesis     122778620   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     122778620    04270 Vascular smooth muscle contraction     122778620   09157 Sensory system    04744 Phototransduction     122778620  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ssen01009]     122778620   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssen04131]     122778620    03036 Chromosome and associated proteins [BR:ssen03036]     122778620   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssen04147]     122778620 Protein phosphatases and associated proteins [BR:ssen01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      122778620 Membrane trafficking [BR:ssen04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     122778620 Chromosome and associated proteins [BR:ssen03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      122778620 Exosome [BR:ssen04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122778620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH EF-hand_FSTL1 EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 Dockerin_1 EF-hand_EFHB_C SAPC2_N EFhand_Ca_insen EF-hand_SWAP70_N UPF0154 EF-hand_14 DUF5580_M EF-hand_STIM1 Adenine_glyco DUF5580 Motif Other DBs NCBI-GeneID:  122778620 NCBI-ProteinID:  XP_043896612 LinkDB All DBs Position LG12:complement(23240487..23240936) Genome browser AA seq 149 aa AA seqDB search MADQLTEEQVEEFREAFSLFDKDSNSTITTKELGTVLRTLGINPTEEALQDMINEVDADG DGTMEFEEFLALMTRKMKDTDTEEEIKEAFRVFDMDGSGFISASELRHVMANLGEKLTDE EVSEMMREADTDGDGKVNYQEFVKMMATK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgatcagctgacagaggagcaggttgaggagttcagggaggcgttttcactcttt gacaaagacagcaatagcaccatcaccaccaaagagctgggcacagtcctgcgcaccctg ggcataaaccccaccgaagaagcgctgcaggacatgatcaacgaagtggacgccgacggg gacggaacgatggagttcgaggagttcctggccctgatgaccaggaagatgaaggacacg gacactgaggaggagatcaaagaggcgttccgcgtcttcgacatggacggcagcggattc atcagcgcgtccgagctgcgtcacgtgatggcgaacctcggagagaagctgacggacgag gaagtgagcgagatgatgagagaagcagatacggacggagacggaaaggtcaactatcaa gagtttgtgaaaatgatggcgacaaagtga

DBGET integrated database retrieval system