Solea senegalensis (Senegalese sole): 122779138 Help Entry 122779138         CDS       T07721                                  Symbol ins Name (RefSeq) insulin   KO K04526   insulin Organism ssen  Solea senegalensis (Senegalese sole) Pathway ssen04010   MAPK signaling pathway ssen04068   FoxO signaling pathway ssen04081   Hormone signaling ssen04114   Oocyte meiosis ssen04140   Autophagy - animal ssen04150   mTOR signaling pathway ssen04810   Regulation of actin cytoskeleton ssen04910   Insulin signaling pathway ssen04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:ssen00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122779138 (ins)    04068 FoxO signaling pathway     122779138 (ins)    04150 mTOR signaling pathway     122779138 (ins)   09133 Signaling molecules and interaction    04081 Hormone signaling     122779138 (ins)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122779138 (ins)   09143 Cell growth and death    04114 Oocyte meiosis     122779138 (ins)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122779138 (ins)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     122779138 (ins)    04914 Progesterone-mediated oocyte maturation     122779138 (ins)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:ssen04052]     122779138 (ins) Cytokines and neuropeptides [BR:ssen04052]  Neuropeptides   Unclassified    122779138 (ins) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  122779138 NCBI-ProteinID:  XP_043897175 LinkDB All DBs Position LG13:complement(18348607..18349661) Genome browser AA seq 118 aa AA seqDB search MAALWLQSVSLLVLLMASWPAGAQAVSAPQHLCGSHLVDALYLVCGDRGFFYNPKRDVDP LLGFLPAKVGGASAAAGSENEAAEFAFKDQMEMMVKRGIVEQCCHKPCNIFDLQNYCN NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggcggcactgtggctccagtctgtctctctgcttgtcttactgatggcgtcgtggccg gcgggcgctcaggctgtctccgcccctcagcacctgtgcggctctcacctagtcgacgcc ctctacctggtctgcggggacagaggcttcttctacaaccccaagagagacgtggacccc ctgctgggtttccttcccgcaaaggtgggcggagcctcagcggcggcaggcagcgagaat gaggcggccgagttcgccttcaaggaccagatggagatgatggtgaagcgcggcattgtg gagcagtgctgccacaaaccctgcaacatctttgacctccagaattactgcaactga

DBGET integrated database retrieval system