Solea senegalensis (Senegalese sole): 122779888 Help Entry 122779888         CDS       T07721                                  Symbol dynll2b Name (RefSeq) dynein, light chain, LC8-type 2b   KO K10418   dynein light chain LC8-type Organism ssen  Solea senegalensis (Senegalese sole) Pathway ssen04814   Motor proteins ssen05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ssen00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     122779888 (dynll2b)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122779888 (dynll2b)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ssen03037]     122779888 (dynll2b)    04812 Cytoskeleton proteins [BR:ssen04812]     122779888 (dynll2b) Cilium and associated proteins [BR:ssen03037]  Motile cilia and associated proteins   Dynein arm    122779888 (dynll2b) Cytoskeleton proteins [BR:ssen04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      122779888 (dynll2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light RP853 Motif Other DBs NCBI-GeneID:  122779888 NCBI-ProteinID:  XP_043898486 LinkDB All DBs Position LG13:22545499..22548025 Genome browser AA seq 89 aa AA seqDB search MSDKKAVIKNADMSDEMQQDSVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGR NFGSYVTHETKHFIYFYLGQVAILLFKSG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtccgacaagaaggccgtgattaaaaatgcagacatgtctgatgagatgcagcaggat tccgtggactgtgccatgcaggcgatggagaagtacaacatagaaaaggacattgctgct tatgtcaaaaaggagtttgataagaagtataatcccacatggcactgcattgttgggagg aacttcggcagctatgtgacacacgagacaaagcatttcatctacttctacctgggtcaa gtggccattcttctcttcaagtcgggctga

DBGET integrated database retrieval system