Solea senegalensis (Senegalese sole): 122785637 Help Entry 122785637         CDS       T07721                                  Symbol rras Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism ssen  Solea senegalensis (Senegalese sole) Pathway ssen04010   MAPK signaling pathway ssen04137   Mitophagy - animal ssen04140   Autophagy - animal ssen04218   Cellular senescence ssen04371   Apelin signaling pathway ssen04519   Cadherin signaling ssen04625   C-type lectin receptor signaling pathway ssen04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:ssen00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     122785637 (rras)    04371 Apelin signaling pathway     122785637 (rras)   09133 Signaling molecules and interaction    04519 Cadherin signaling     122785637 (rras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     122785637 (rras)    04137 Mitophagy - animal     122785637 (rras)   09143 Cell growth and death    04218 Cellular senescence     122785637 (rras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     122785637 (rras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     122785637 (rras)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssen04147]     122785637 (rras)    04031 GTP-binding proteins [BR:ssen04031]     122785637 (rras) Exosome [BR:ssen04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    122785637 (rras)   Exosomal proteins of bladder cancer cells    122785637 (rras) GTP-binding proteins [BR:ssen04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     122785637 (rras) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 DUF3234 DUF192 Motif Other DBs NCBI-GeneID:  122785637 NCBI-ProteinID:  XP_043907464 LinkDB All DBs Position LG19:complement(20360913..20369833) Genome browser AA seq 197 aa AA seqDB search MSGDEERFKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTVDGKETRMDIL DTAGQEEFGAMREQYMRSGEGFLLVFALNDRGSFHEVQKFHTQILRVKDRDDFPMVLVGN KADLEQQRVISREDAQAFARENRIHYMEASAKNRYNVDETFLELVQIIRMFQEMECPPPP AHHTGKQKSGGCPCVLL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcggagacgaggagaggttcaaactggtggtggtcggaggaggaggggtgggcaag agcgccctcaccattcagttcattcagtcctactttgtgtcagattacgaccccaccatc gaagactcctacaccaagatctgcactgtggatggaaaagagacccggatggacatcttg gatacagcaggtcaggaggaatttggagcaatgagggagcagtacatgcgctcaggagaa ggtttcctcctggtgtttgcacttaacgacaggggaagcttccacgaggttcagaaattc cacacccagatcttgcgagtgaaggaccgcgacgacttccccatggtgctggtcggaaac aaggctgacctggaacagcagagagtgatctccagggaggacgctcaggcgtttgccaga gaaaacaggatccactacatggaggcgtcggctaaaaatcgctacaatgtggacgaaacc tttttagagttggtgcaaattatcaggatgtttcaggagatggagtgtcctcctccccca gctcatcatacagggaaacagaagagtggaggatgtccctgcgtcctcctctaa

DBGET integrated database retrieval system