Solea senegalensis (Senegalese sole): 122786907 Help Entry 122786907         CDS       T07721                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism ssen  Solea senegalensis (Senegalese sole) Pathway ssen04382   Cornified envelope formation ssen05132   Salmonella infection Brite KEGG Orthology (KO) [BR:ssen00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     122786907  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     122786907  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssen04147]     122786907 Exosome [BR:ssen04147]  Exosomal proteins   Exosomal proteins of microglial cells    122786907 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 NNH2 SPARC_Ca_bdg EH Motif Other DBs NCBI-GeneID:  122786907 NCBI-ProteinID:  XP_043909367 LinkDB All DBs Position LG20:complement(5533062..5534547) Genome browser AA seq 101 aa AA seqDB search MPSELEVAMESLIKVFHRYTSKEGSSATLSKKELKDLMANELSNFLESQKDPAAIDKIMK DLDTNGDGQVDFEEFVSLVVGLSVACEQCYQMHLRQQSYRK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgccttcagaactggaagttgccatggagtcccttatcaaggtgttccaccgttacacc tctaaagagggaagttcagccacactatcaaagaaagagcttaaggatctgatggcgaac gagctttccaacttccttgagtctcagaaggaccctgctgctatcgacaagatcatgaag gacctggacaccaatggcgacggccaggtggactttgaggagtttgtttctctggttgtt ggactgtcagttgcttgtgagcagtgctatcagatgcacctgaggcagcagtcgtacaga aagtga

DBGET integrated database retrieval system