Streptococcus suis A7 (serotype 2): SSUA7_1627 Help Entry SSUA7_1627        CDS       T02020                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssf  Streptococcus suis A7 (serotype 2) Pathway ssf01100   Metabolic pathways ssf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SSUA7_1627 (acpP)    00074 Mycolic acid biosynthesis     SSUA7_1627 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SSUA7_1627 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding TerB Motif Other DBs NCBI-ProteinID:  AER44946 LinkDB All DBs Position complement(1644714..1644938) Genome browser AA seq 74 aa AA seqDB search MAVFEKVQEIIVEELGKDAEEVTLTTTFEDLDADSLDLSQVISEIEDAFDIQIDTEEGLT TVGDLVAYVEEKTK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggcagtatttgaaaaagtacaggaaatcatcgttgaagaattgggtaaggatgctgaa gaagtaactcttacaacaacctttgaggatttggacgcagattcattggatctttcccaa gttatctctgaaatcgaagatgcattcgacatccaaatcgacactgaagaaggtttgact actgtaggcgatttggttgcttatgttgaagaaaaaacaaaataa

DBGET integrated database retrieval system