Selenomonas sputigena: Selsp_1726 Help Entry Selsp_1726        CDS       T01474                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ssg  Selenomonas sputigena Pathway ssg00998   Biosynthesis of various antibiotics ssg01100   Metabolic pathways ssg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Selsp_1726    00074 Mycolic acid biosynthesis     Selsp_1726   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Selsp_1726 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AEC00682 UniProt:  C9LSK8 LinkDB All DBs Position complement(1895882..1896127) Genome browser AA seq 81 aa AA seqDB search MATFDKVKDIVVEQLGVEADEVSIDSTFIDDLGADSLDIVELIMAFEEEFGIEIPDEAAE KIKTVQDVVTYIDQHKEDEGK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt gtggcgacttttgataaagtgaaagatatcgttgtggagcagctcggcgttgaagcggac gaggtttccatcgattctacttttattgacgatctgggagcagattccttggacatcgtt gagctcatcatggcattcgaagaggagttcggaattgagattccggacgaggcagcggaa aagatcaagaccgttcaggatgtcgtaacttacattgaccagcacaaagaagacgagggc aagtaa

DBGET integrated database retrieval system