Staphylococcus schweitzeri: NCTC13712_01249 Help Entry NCTC13712_01249   CDS       T06947                                  Symbol hfq Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism ssh  Staphylococcus schweitzeri Pathway ssh02024   Quorum sensing ssh03018   RNA degradation Brite KEGG Orthology (KO) [BR:ssh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     NCTC13712_01249 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     NCTC13712_01249 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ssh03019]     NCTC13712_01249 (hfq)    03036 Chromosome and associated proteins [BR:ssh03036]     NCTC13712_01249 (hfq) Messenger RNA biogenesis [BR:ssh03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      NCTC13712_01249 (hfq) Chromosome and associated proteins [BR:ssh03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     NCTC13712_01249 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq DUF4809 Hfq_1 MBG LSM Motif Other DBs NCBI-ProteinID:  VEE65828 LinkDB All DBs Position 1:1310092..1310325 Genome browser AA seq 77 aa AA seqDB search MIANENIQDKALENFKVNQTEVTVFFLNGFQMKGVIEEFDKYVVSLNSQGKQHLIYKHAI STYTVESEAQASTNSEE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgattgcaaatgaaaacatccaagacaaagcactagagaattttaaagtaaaccaaact gaagtaacggtattctttctaaacggtttccaaatgaaaggtgtaattgaagaattcgac aagtatgtcgtaagcttaaattctcaaggcaaacaacacttgatttacaaacatgcgatc agcacttacacagtagaatctgaagctcaagcgtctactaatagtgaagaataa

DBGET integrated database retrieval system