KEGG   Streptomyces alfalfae: A7J05_09250
Entry
A7J05_09250       CDS       T05110                                 

Name
(GenBank) taurine catabolism dioxygenase
  KO
K18057  pentalenolactone F synthase [EC:1.14.11.36]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00999  Biosynthesis of various secondary metabolites - part 1
ssia01100  Metabolic pathways
ssia01110  Biosynthesis of secondary metabolites
Module
ssia_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various secondary metabolites - part 1
    A7J05_09250
Enzymes [BR:ssia01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.36  pentalenolactone F synthase
     A7J05_09250
SSDB
Motif
Pfam: TauD
Other DBs
NCBI-ProteinID: APY85877
UniProt: A0A1P8TE29
LinkDB
Position
complement(2311039..2311938)
AA seq 299 aa
MDVTPIPGAALGAVVDGAHVSGDMDEAQANEIWAALDAHLVLVFRGHETPTYEEFLAFGR
RFGHIPKTGLTSGAHPDHNEILIVSNLVEDGRKIGVGDAGWMGWHTDYSFRPRVSQVGFL
EAVEVPPSGGGETLFTDMYALYESLPAEERRRLHSYRVRHALRTGYEETIEEELQGEVSL
GEDPRRIRAEDGTSTVHPLVARNPRTGRRSVYVSTLNTERIVDLAPDAGRELLDKLLAHA
GTPRHTYAHTWRPGDIVMWDQLGTVHAKRAFDPAERRVMRQVVSIFDDPTAPWRAEAAA
NT seq 900 nt   +upstreamnt  +downstreamnt
atggacgtcacgccgatacccggcgccgctctcggcgccgtcgtggacggcgcccatgtc
tcgggcgacatggacgaggcacaggcgaacgagatctgggcggcgctcgacgcgcacctc
gtcctggtcttccgcggccacgagaccccgacctacgaggagttcctggccttcggccgc
cgcttcgggcatatcccgaagaccggcctgaccagcggcgcccaccccgaccacaatgag
atcctgatcgtctccaacctggtggaggacggccgcaagatcggcgtcggcgacgccggg
tggatgggctggcacaccgactactccttccgcccccgcgtctcccaggtcggcttcctc
gaagccgtcgaagtgccgccctccggcggcggcgagaccctcttcaccgacatgtacgcc
ctgtacgagtccctgcccgccgaggagcgccggcgtctgcactcctaccgggtccgccac
gccctgcgcaccggctacgaggagaccatcgaggaggaactccagggcgaggtgtccctc
ggcgaggacccccgtcggatcagggccgaggacggcacctccaccgtccacccgctggtc
gcccgcaacccgcgcaccggccgccgctcggtctacgtcagcaccctgaacaccgagcgg
atcgtggacctcgcccccgacgccggccgcgaactgctcgacaagctcctcgcgcacgcg
ggcaccccccggcacacctacgcccacacctggcggcccggggacatcgtcatgtgggac
cagctcggcaccgtccacgccaagcgggccttcgacccggccgaacggcgcgtcatgcgc
caggtcgtcagcatcttcgacgacccgaccgccccctggcgagcggaggccgccgcatga

DBGET integrated database retrieval system