Streptomyces alfalfae: A7J05_09930 Help Entry A7J05_09930       CDS       T05110                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism ssia  Streptomyces alfalfae Pathway ssia00261   Monobactam biosynthesis ssia01100   Metabolic pathways ssia01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssia00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A7J05_09930  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ssia01008]     A7J05_09930 Polyketide biosynthesis proteins [BR:ssia01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A7J05_09930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  APY85987 UniProt:  A0A1P8TEE1 LinkDB All DBs Position complement(2493112..2493324) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDPEGRFLVLVNDEGQHSIWPSFAEVPGGWTVAFEENTRDACIEYVETNWTDLR PRSLAASMDA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaacccctttgatgaccccgaaggccgtttcctggtcctggtgaacgacgag gggcagcactcgatctggccgtccttcgccgaggtgcccggaggctggacggtcgccttc gaggaaaacaccagggatgcgtgcatcgagtacgtcgaaaccaactggacggacctgcgt ccccgctccctcgcggcatccatggacgcctga

DBGET integrated database retrieval system