KEGG   Streptomyces alfalfae: A7J05_21335
Entry
A7J05_21335       CDS       T05110                                 
Name
(GenBank) hypothetical protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00333  Prodigiosin biosynthesis
ssia01100  Metabolic pathways
ssia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    A7J05_21335
SSDB
Motif
Pfam: Nitroreductase TM1586_NiRdase
Other DBs
NCBI-ProteinID: APY91012
UniProt: A0A1P8TTQ4
LinkDB
Position
complement(5103077..5104276)
AA seq 399 aa
MPSRTLVTCSDFGRALRTAAGTARLAPSSHNCQPWALLRLSGADARASAARLLRQPGGGP
ARADSEYVAVVLDRGRQLDSLASHELEMQLSCGAFTQLLTRTLACQGWWLERAVLTDEPG
GWAYRSVPAPVRALRDAGWRPDWSLLAVLELRYAGMPEGSLTEYQELTAARRTNRGPYQD
RAVPADVLEQLLKPAPGLAAEADLDIRHLTARTDLDRFVSFVARYAGRDFSHPEAWRETY
AYIRPTRAEAERRGDGFALSQLFGPLHPLRAAALRTALRPATMRVLRHVGYPRVLASRMA
AAIRPTPAVVAMGLTPGSPGAADVLRAGARLADYWLTATRHSLALHPISIVLQHEDLRER
LQSCLGLPGRTVFVSRLGHAETGFPPAPRRGADTFTHTL
NT seq 1200 nt   +upstreamnt  +downstreamnt
atcccgtcccgcaccctggtcacctgcagcgacttcggccgcgccctgcggaccgccgcc
gggaccgcccggctcgccccgtcctcgcacaactgccagccctgggccctgctcaggctg
agcggcgcggacgcgcgcgcgagcgccgcccggctgctgcggcagcccggcggcgggccc
gcgcgcgccgacagcgagtacgtcgccgtcgtcctcgaccgcggcaggcagctcgactcg
ctggcctcgcacgagctggagatgcagctgagctgcggcgccttcacccagctcctgacc
cggaccctggcctgccaggggtggtggctggaacgcgccgtgctcaccgacgagcccggc
ggctgggcctaccgcagcgtccccgccccggtgcgcgccctgcgcgacgcgggctggcgc
cccgactggtccctcctcgccgtcctggaactgcgctacgcgggcatgcccgagggcagc
ctgacggagtaccaggagctcaccgcggcccgcaggaccaaccgcgggccctaccaggac
cgcgccgtgccggccgacgtcctcgaacagctgctcaagccggcgccggggctcgccgcc
gaggccgacctcgacatcaggcacctcaccgcgcggaccgacctggaccgcttcgtctcc
ttcgtcgcgcgctacgcgggccgggacttcagccaccccgaggcctggcgcgagacgtac
gcgtacatccgccccacccgcgccgaggccgagcggcgcggcgacggcttcgccctgagc
cagctgttcgggcccctgcacccgctgcgggccgcggccctgcgcaccgcgctgcgcccc
gccaccatgcgggtcctgcggcacgtgggctatccgcgggtcctcgcctcccggatggcc
gcggcgatccggcccaccccggccgtggtcgccatgggtctgacgccgggctcgccggga
gcggcggacgtcctgcgcgccggcgcgcggctcgcggactactggctgacggccacccgg
cactctctcgcgctgcatcccatcagcatcgtcctccagcacgaggacctgcgcgaacgg
ctccagtcctgcctgggcctgccggggcgcaccgtcttcgtcagccgcctggggcacgcg
gagaccggcttccccccggcgccgcgcaggggggcggacaccttcacgcacacgctgtag

DBGET integrated database retrieval system