Streptomyces alfalfae: A7J05_33120 Help Entry A7J05_33120       CDS       T05110                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism ssia  Streptomyces alfalfae Pathway ssia03060   Protein export ssia03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:ssia00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     A7J05_33120  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     A7J05_33120  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ssia02044]     A7J05_33120 Secretion system [BR:ssia02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    A7J05_33120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E DUF2505 DUF4887 Motif Other DBs NCBI-ProteinID:  APY89879 LinkDB All DBs Position 7733586..7733870 Genome browser AA seq 94 aa AA seqDB search MFGLSEIAIILIVVILVFGAKKLPELARSAGKSARILKAEAKAMREEKEREEARRAAAQP PQVLHGEVVPPDAVPPTVRQARTQDTDTSSQRRV NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gtgttcggactgagcgaaatcgcgatcatcctcatcgtcgtcatcctcgtgttcggcgcc aagaagctcccagaactggcccggtcggcgggcaagtcggcgcgcatcctcaaggccgag gccaaggccatgcgggaggagaaggagcgggaggaggcccggagggcggcggcgcagccg ccccaggtcctccacggggaggtcgtcccgccggacgccgttccgccgaccgtgcggcag gcgcgtacgcaggacacggacacatcgtcccagcggcgcgtctga

DBGET integrated database retrieval system