Streptomyces alfalfae: A7J05_34505 Help Entry A7J05_34505       CDS       T05110                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssia  Streptomyces alfalfae Pathway ssia00998   Biosynthesis of various antibiotics ssia01100   Metabolic pathways ssia01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssia00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A7J05_34505    00074 Mycolic acid biosynthesis     A7J05_34505   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A7J05_34505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF5856 Motif Other DBs NCBI-ProteinID:  APY90100 LinkDB All DBs Position 8058364..8058651 Genome browser AA seq 95 aa AA seqDB search MQAEKQEHKRDQELFDKIVKHIGEFVEADVSHLTPQSNIGNSIEGMSSLKMVELLLFLED CFGVDFDESVMDDLQTMGDLEQYIRRTLDASEQRA NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgcaggctgagaagcaggagcacaagcgggaccaggaacttttcgacaagatcgtcaag cacatcggggagttcgtcgaagccgacgtgtcccacctgacgccgcagtcgaacatcggc aactccatcgagggcatgagttcactcaagatggtcgaactgctgctcttcctggaggac tgcttcggtgtcgacttcgacgagtccgtgatggacgacctgcagaccatgggggacctg gagcagtacatccggcggacactggacgcgtccgagcagcgggcctga

DBGET integrated database retrieval system