Staphylococcus simulans: AL483_05640 Help Entry AL483_05640       CDS       T04303                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssif  Staphylococcus simulans Pathway ssif01100   Metabolic pathways ssif01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssif00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AL483_05640   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AL483_05640 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AMG96324 UniProt:  A0A133QWV1 LinkDB All DBs Position complement(1140177..1140410) Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVNFINNLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaacttcgataaagttaaagatatcatcgttgaccgtttaggtgtagatgctgac aaagtaactgaagatgcatctttcaaagatgatttaggcgctgactcacttgatatcgca gaattagttatggaattagaagacgagttcggtactgaaattccagatgaagaagctgaa aaaatcaatacagttggtgacgcagtaaacttcatcaataaccttgaaaaataa

DBGET integrated database retrieval system