KEGG   Solibacillus silvestris DSM 12223: SOLI23_19585
Entry
SOLI23_19585      CDS       T04506                                 

Definition
(GenBank) 2,3-dihydroxybiphenyl 1,2-dioxygenase
  KO
K00462  biphenyl-2,3-diol 1,2-dioxygenase [EC:1.13.11.39]
Organism
ssil  Solibacillus silvestris DSM 12223
Pathway
ssil00361  Chlorocyclohexane and chlorobenzene degradation
ssil00621  Dioxin degradation
ssil01100  Metabolic pathways
ssil01120  Microbial metabolism in diverse environments
ssil01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ssil00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    SOLI23_19585
   00621 Dioxin degradation
    SOLI23_19585
Enzymes [BR:ssil01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.39  biphenyl-2,3-diol 1,2-dioxygenase
     SOLI23_19585
SSDB
Motif
Pfam: Glyoxalase Glyoxalase_4 RraB
Other DBs
NCBI-ProteinID: AMO87628
UniProt: A0A1A7LGI0
LinkDB
Position
3967789..3968742
AA seq 317 aa
MTNPEISKLGHFGLVSTDLEKSLWFFKEVIGLEETEEADGVHYLRAWGDFEHHTLTLRAG
EESRLDHIAWRTKRPEDVDAFAENLQKEGIEINWVEEGTERGQGKAFRFQLPSKHTFEIY
FDMEKTLAAPETRSVLKNQTHKSWNRGVSPRRIDHVNLLSSIPANEFSDFMIQHLGFNLR
EYVEAPDGSYLGAWLSVTPLVHDIAFSFDPHSASTHEVHHISYWLDNAQDLLRAADILKE
NGIEFKGPGKHGISQAMYIYAIDPGSGVRLEIFTNGYLIFEPDWEPIRWTLDEMSLGFTY
WGDQMDNNPENNPTIKA
NT seq 954 nt   +upstreamnt  +downstreamnt
atgacaaatccggaaatttcaaaacttggccactttggtttagtaagtacagatttagaa
aaatcactttggttttttaaagaagtaattggtcttgaagaaacagaagaagcagacggt
gttcactatttacgtgcatggggtgacttcgagcaccatacattaacgcttcgtgctggt
gaagagtctcgccttgatcatattgcatggcgtacaaaacgtcctgaagatgtagatgct
tttgctgaaaatctgcaaaaagaaggaatcgaaatcaattgggtagaggaaggcacggaa
agaggtcaaggaaaagcattccgcttccagcttcctagtaaacatacatttgaaatctat
tttgatatggaaaaaacattagctgcaccggaaacacgttctgtattaaaaaatcagacg
cataaatcatggaatagaggagtatcaccgcgtcgtattgaccatgtgaatctattaagc
tctataccggcaaatgaattttcagattttatgatacaacacttaggctttaacttacgt
gaatatgtggaagcaccggacggcagctatttaggcgcatggttaagtgtaacaccactt
gtacacgacatcgcatttagctttgatccgcattccgcatctacacacgaagtacaccat
atttcatactggctggataatgcacaggatttattacgtgcagcggatattttaaaggaa
aacggtattgagtttaaaggtccaggaaaacacggtatttcacaggcaatgtacatttat
gcaattgaccctggtagtggagttcgtctggaaatcttcacaaacggctatttaattttc
gagccggattgggagccaattcgttggacgttagatgagatgagcttaggtttcacttat
tggggcgatcaaatggacaataaccctgaaaataacccgacaattaaagcgtaa

DBGET integrated database retrieval system