Sphingomonas sinipercae: G7078_00840 Help Entry G7078_00840       CDS       T07461                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssin  Sphingomonas sinipercae Pathway ssin01100   Metabolic pathways ssin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssin00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G7078_00840    00074 Mycolic acid biosynthesis     G7078_00840   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G7078_00840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Guanylate_cyc Motif Other DBs NCBI-ProteinID:  QIL01476 UniProt:  A0A6G7ZKP8 LinkDB All DBs Position 165417..165665 Genome browser AA seq 82 aa AA seqDB search MTDRDEMYAQILKLIEPFNKKGAEVSEATRFQQDLEWDSLTVMDFVASVEDEFDILISMN KAAEIETVGQLVDAVEQLQAER NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgaccgaccgagacgaaatgtacgcccagatcctcaagctgatcgagccgttcaataag aagggcgccgaggtcagcgaggccacccgattccagcaggacctggaatgggacagcctg acggtgatggatttcgtcgcctcggtcgaggacgagttcgatatcctgatcagcatgaac aaggcagccgagatcgagaccgtcggccaactggtcgatgccgtcgagcagctgcaggcg gaacggtga

DBGET integrated database retrieval system