Sphingomonas sinipercae: G7078_08925 Help Entry G7078_08925       CDS       T07461                                  Name (GenBank) ATP synthase F1 subunit epsilon   KO K02114   F-type H+-transporting ATPase subunit epsilon Organism ssin  Sphingomonas sinipercae Pathway ssin00190   Oxidative phosphorylation ssin01100   Metabolic pathways Module ssin_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:ssin00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     G7078_08925  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:ssin00194]     G7078_08925 Photosynthesis proteins [BR:ssin00194]  Photosystem and electron transport system   F-type ATPase [OT]    G7078_08925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_DE_N Motif Other DBs NCBI-ProteinID:  QIL02894 UniProt:  A0A6G7ZPI2 LinkDB All DBs Position 1712908..1713174 Genome browser AA seq 88 aa AA seqDB search MADLHFVIVTPERQLRSEDVYMVVVPGTEGQSGILAGHAPYMTTLQDGDVEVYKSAGATP ERIRVSGGFAEVGPGGLTILAEGADEAA NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggccgatctccacttcgtaatcgtcacgccggagcgccagctgcgttccgaagacgtc tacatggttgtcgtgcccggcaccgagggccagtcaggcatcctggctggccacgcaccg tacatgacgacgctgcaggacggcgatgtcgaagtctataagagcgcgggcgcaacgccg gagcggatcagggtcagcggcggattcgccgaagtcggcccgggcggtctcaccattttg gctgaaggcgccgacgaggccgcctaa

DBGET integrated database retrieval system