Streptomyces sirii: WAB15_13485 Help Entry WAB15_13485       CDS       T11107                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssir  Streptomyces sirii Pathway ssir00998   Biosynthesis of various antibiotics ssir01100   Metabolic pathways ssir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssir00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WAB15_13485    00074 Mycolic acid biosynthesis     WAB15_13485   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WAB15_13485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  WXK76925 UniProt:  A0ABZ2QKD2 LinkDB All DBs Position 2996151..2996399 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVKGLAEIVNEIAGIPTEDVQVDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATDYILKHQS NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcaagggtctcgccgagatcgtgaacgagatcgcc ggcatcccgaccgaggacgtccaggtggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtggtcgtcgccgccgaagagcgcttcgacgtgaagatcccc gacgacgacgtcaagaacctcaagacggtcggcgacgcgaccgactacatcctcaagcac cagagctga

DBGET integrated database retrieval system