Streptomyces sirii: WAB15_32770 Help Entry WAB15_32770       CDS       T11107                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ssir  Streptomyces sirii Pathway ssir00998   Biosynthesis of various antibiotics ssir01100   Metabolic pathways ssir01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ssir00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WAB15_32770    00074 Mycolic acid biosynthesis     WAB15_32770   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WAB15_32770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding RDM Motif Other DBs NCBI-ProteinID:  WXK80404 UniProt:  A0ABZ2R1I7 LinkDB All DBs Position complement(7370292..7370564) Genome browser AA seq 90 aa AA seqDB search MTTSHPTVTEEQARQLREIVIDVLELEPEELTETSHFVNDHEADSLLAIEILARIEQDLD VEIPQDQLPEMVNLTGVRDVFARNQKGADQ NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaccacgtcgcaccccaccgtgaccgaagagcaggcccggcagctgcgcgagatcgtc atcgacgtactggagctggagcccgaggagctgacggagaccagccacttcgtcaacgac cacgaggccgactccctgctggccatcgagatcctcgcgcgaatcgaacaggacctggac gtcgagatcccgcaggaccagctcccggagatggtcaacctcaccggggtacgggacgtc ttcgcccgcaaccaaaagggtgcggatcagtga

DBGET integrated database retrieval system