Sclerotinia sclerotiorum: SS1G_00403 Help Entry SS1G_00403        CDS       T01071                                  Name (RefSeq) hypothetical protein   KO K11511   centromere protein S Organism ssl  Sclerotinia sclerotiorum Pathway ssl03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:ssl00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     SS1G_00403  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ssl03036]     SS1G_00403    03400 DNA repair and recombination proteins [BR:ssl03400]     SS1G_00403 Chromosome and associated proteins [BR:ssl03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      SS1G_00403 DNA repair and recombination proteins [BR:ssl03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      SS1G_00403 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CENP-S CENP-T_C Histone Bromo_TP TFIID-18kDa ORC1_wHTH TFIID-31kDa KH_PARP14_6 TAF Motif Other DBs NCBI-GeneID:  5494608 NCBI-ProteinID:  XP_001598317 UniProt:  A7E531 A0A1D9PZ62 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MDADLHDRLKAALWFSIGKIVEEESIRLNSNATNQFIGALTEMVWHQIENVTMDLESFSR HAGRSTITTDDVLLVTRRNDALHDMIKNFIDKEKAQSTGEKGKSRTKK NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggatgctgacctccacgatcggctcaaagcagctctttggttctcaattgggaagatt gtggaagaggaatccattcgacttaattcaaatgctacaaaccaattcataggagcatta actgaaatggtatggcatcaaatagaaaatgtaacgatggatctcgaaagtttctcgcga cacgctggacgatctaccattaccaccgatgatgtattactcgttacgaggaggaacgat gcgttacacgatatgatcaagaattttatagataaagagaaggcccaatctacgggtgaa aagggaaaaagtcgcaccaagaaatga

DBGET integrated database retrieval system