Sclerotinia sclerotiorum: SS1G_00913 Help Entry SS1G_00913        CDS       T01071                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism ssl  Sclerotinia sclerotiorum Pathway ssl03022   Basal transcription factors ssl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ssl00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     SS1G_00913   09124 Replication and repair    03420 Nucleotide excision repair     SS1G_00913  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ssl03021]     SS1G_00913    03400 DNA repair and recombination proteins [BR:ssl03400]     SS1G_00913 Transcription machinery [BR:ssl03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      SS1G_00913 DNA repair and recombination proteins [BR:ssl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      SS1G_00913 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  5495127 NCBI-ProteinID:  XP_001598824 UniProt:  A0A1D9PY60 A7E6I8 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MPRAIRGVLVECDPSIKSIVVKIDADSSHAYIVEDLDDETLVIKENMLGMLKARLEDALK ETQVLDDSGSE NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgccacgagctatcagaggtgtcctcgtggaatgcgatccatctatcaaatccatcgtc gtcaaaatagatgccgattcatcgcatgcgtatattgtcgaggatttagatgatgaaact ctagtcatcaaagagaatatgttggggatgttgaaggcgcgtttagaagatgcgcttaag gagacgcaggttttggatgattcgggctctgagtag

DBGET integrated database retrieval system