Sclerotinia sclerotiorum: SS1G_00997 Help Entry SS1G_00997        CDS       T01071                                  Name (RefSeq) hypothetical protein   KO K11567   DASH complex subunit DAD2 Organism ssl  Sclerotinia sclerotiorum Brite KEGG Orthology (KO) [BR:ssl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:ssl03036]     SS1G_00997 Chromosome and associated proteins [BR:ssl03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     DASH complex      SS1G_00997 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DASH_Dad2 DASH_Duo1 DUF5407 NBCH_WD40 DUF7310 Motif Other DBs NCBI-GeneID:  5494377 NCBI-ProteinID:  XP_001598908 UniProt:  A7E6S2 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MGGSLGSSSSQSPILQARINEKRAELENLKQLRDLSAGLAGQMQMLEEKLSTLSDGTEAV ATVLGNWHNVLQAISMASSRSQGTFLPTPVF NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgggtggtagtctaggctcatcctctagtcaatcccccatcttgcaggcgcgcatcaac gaaaagagggcagagctagaaaatctgaagcaattacgagatttgagcgcagggctagct ggacagatgcaaatgttggaagagaagctttcgactctttctgacggaacagaagctgtc gcaacagtgttgggaaactggcacaatgttctgcaggccatcagtatggcatctagtagg tcacaaggtacttttctaccaaccccagtcttctaa

DBGET integrated database retrieval system