Sclerotinia sclerotiorum: SS1G_01602 Help Entry SS1G_01602        CDS       T01071                                  Name (RefSeq) hypothetical protein   KO K08341   GABA(A) receptor-associated protein Organism ssl  Sclerotinia sclerotiorum Pathway ssl04136   Autophagy - other ssl04138   Autophagy - yeast ssl04139   Mitophagy - yeast Brite KEGG Orthology (KO) [BR:ssl00001]  09140 Cellular Processes   09141 Transport and catabolism    04138 Autophagy - yeast     SS1G_01602    04136 Autophagy - other     SS1G_01602    04139 Mitophagy - yeast     SS1G_01602  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssl04131]     SS1G_01602    04121 Ubiquitin system [BR:ssl04121]     SS1G_01602    03029 Mitochondrial biogenesis [BR:ssl03029]     SS1G_01602 Membrane trafficking [BR:ssl04131]  Autophagy   Autophagosome formation proteins    Atg8 conjugation proteins     SS1G_01602 Ubiquitin system [BR:ssl04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    SS1G_01602 Mitochondrial biogenesis [BR:ssl03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     SS1G_01602 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ATG8 APG12 Motif Other DBs NCBI-GeneID:  5493212 NCBI-ProteinID:  XP_001597408 UniProt:  A7E8H4 A0A1D9PTE5 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MRSKFKDEHPFEKRKAEAERIRQKYSDRIPVICEKVEKSDIATIDKKKYLVPSDLTVGQF VYVIRKRIKLSPEKAIFIFVDEVLPPTAALMSSIYEEHKDEDGFLYISYSGENTFGEALE EAN NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgcgatccaagtttaaggacgagcatcccttcgagaagcgcaaggctgaagcagaacgc atccgccaaaaatactccgaccgtatccccgtaatctgcgagaaggtcgagaaatcggat attgccactatcgacaagaagaagtacctcgttcccagcgatctcaccgtcggtcaattc gtctatgtcatccgcaaacgtatcaagctttcccccgaaaaggcaatcttcatcttcgtc gatgaggtcttaccgcctactgccgctttgatgagctccatctacgaggaacacaaagat gaggatggcttcctatacatctcctactcgggcgaaaacaccttcggtgaagccttagaa gaagccaactaa

DBGET integrated database retrieval system