Sclerotinia sclerotiorum: SS1G_02390 Help Entry SS1G_02390        CDS       T01071                                  Name (RefSeq) predicted protein   KO K03872   elongin-C Organism ssl  Sclerotinia sclerotiorum Pathway ssl04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:ssl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     SS1G_02390  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ssl04121]     SS1G_02390    03400 DNA repair and recombination proteins [BR:ssl03400]     SS1G_02390 Ubiquitin system [BR:ssl04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      SS1G_02390    Cul5 complex      SS1G_02390 DNA repair and recombination proteins [BR:ssl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      SS1G_02390 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  5492739 NCBI-ProteinID:  XP_001596174 UniProt:  A7EAQ8 A0A1D9Q132 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MAAPGTSKYVTLVSCDGFEFVVLREAALTSGAIKKMLDTTSGWEESQTGICRFAEINGIV LEKVAEYFYYNYKYRNSENVPDMEIPAELCLELLMAADYLDT NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggcagcaccaggtacaagcaaatatgtgactctcgtatcttgcgacggatttgaattc gtcgttctgagagaggctgctttgacaagtggtgcaatcaaaaagatgctggatacaacc agtggttgggaagagtctcaaacaggaatctgccgtttcgcagaaataaatggtattgtc ctcgagaaggtcgccgaatacttttactacaactacaaatatcgcaactcggagaatgtg ccagacatggagattccggcagagttgtgtctagagttgttaatggcagctgattatctg gacacataa

DBGET integrated database retrieval system