Sclerotinia sclerotiorum: SS1G_05902 Help Entry SS1G_05902        CDS       T01071                                  Name (RefSeq) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism ssl  Sclerotinia sclerotiorum Pathway ssl03060   Protein export ssl04141   Protein processing in endoplasmic reticulum ssl04145   Phagosome Brite KEGG Orthology (KO) [BR:ssl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SS1G_05902    04141 Protein processing in endoplasmic reticulum     SS1G_05902  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     SS1G_05902  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssl04131]     SS1G_05902   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ssl02044]     SS1G_05902 Membrane trafficking [BR:ssl04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     SS1G_05902 Secretion system [BR:ssl02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    SS1G_05902 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Sec61_beta DUF1180 Motif Other DBs NCBI-GeneID:  5489057 NCBI-ProteinID:  XP_001592980 UniProt:  A7EKQ5 A0A1D9Q4P3 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MSSPRSASPANSPVATASGRPSSPTPPGGPKTAIRRRAAADQKDKVANARPSSTRAAGAG GSSSTMLRLYTDESPGLKVDPVVVLVLSLVFIFSVVALHIIAKVTRKFSS NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgtcatccccaagatcggcatccccagccaacagcccggtagcaacagcctcgggtaga ccttctagcccaacacctcctggtggcccaaagacggcgattagaagacgggcggcggca gatcagaaggataaggtggcaaatgctaggccgagtagtacgagggcggcgggtgcgggt ggtagctcgagtactatgttgagactttacaccgacgaatccccaggattaaaggtcgac cccgtcgttgttttggttctctctcttgtcttcatcttcagcgttgttgcccttcacatt atcgcaaaggtcactcgcaaattctcttcttaa

DBGET integrated database retrieval system