Sclerotinia sclerotiorum: SS1G_06114 Help Entry SS1G_06114        CDS       T01071                                  Name (RefSeq) hypothetical protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism ssl  Sclerotinia sclerotiorum Pathway ssl03020   RNA polymerase ssl03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ssl00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     SS1G_06114   09124 Replication and repair    03420 Nucleotide excision repair     SS1G_06114  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ssl03021]     SS1G_06114    03400 DNA repair and recombination proteins [BR:ssl03400]     SS1G_06114 Transcription machinery [BR:ssl03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      SS1G_06114 DNA repair and recombination proteins [BR:ssl03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       SS1G_06114 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L CorA Motif Other DBs NCBI-GeneID:  5489106 NCBI-ProteinID:  XP_001593192 UniProt:  A7ELB7 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MSNAPERFELFILGDGEKKCTEEADTRTPNSSIFTFNKEDHTLANMLRAHLLKDPHVIFS GYKIPHPLFSKFELRIQTDGEITPKEALVACCRNLVSELEVFSREFTKEFELRKMVSGDV AADK NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgtctaacgcgcctgagagattcgagttatttatccttggagatggcgagaagaagtgt actgaggaggccgatacccgtactcccaactcttcaatctttacctttaacaaggaagat catacccttgccaatatgctacgtgctcatttattgaaagatccgcacgttatattctcc ggttacaaaatcccccatcccctcttttccaaattcgagcttcgcattcaaaccgatggt gaaatcactcccaaggaagctcttgtcgcctgttgccgtaatttggtatctgaacttgag gtgttcagccgcgagtttactaaggagtttgagctacgcaagatggtcagtggagatgta gctgccgacaaatga

DBGET integrated database retrieval system