Sclerotinia sclerotiorum: SS1G_06785 Help Entry SS1G_06785        CDS       T01071                                  Name (RefSeq) hypothetical protein   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism ssl  Sclerotinia sclerotiorum Pathway ssl03018   RNA degradation ssl03040   Spliceosome Brite KEGG Orthology (KO) [BR:ssl00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     SS1G_06785   09123 Folding, sorting and degradation    03018 RNA degradation     SS1G_06785  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ssl03019]     SS1G_06785    03041 Spliceosome [BR:ssl03041]     SS1G_06785 Messenger RNA biogenesis [BR:ssl03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      SS1G_06785   mRNA degradation factors    5'-3' decay     Lsm complex      SS1G_06785 Spliceosome [BR:ssl03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     SS1G_06785 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  LSM Gemin6 KOW7_SPT5 Motif Other DBs NCBI-GeneID:  5488409 NCBI-ProteinID:  XP_001592544 UniProt:  A7EN86 A0A1D9QIQ7 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MSLSSYVNKKVLILTADSRTLVGTLLSCDQQTNLVLSQTIERIIRPPEDPEASSEVPHGL YLIRGDNVVVVGLVDEELDDSINWVEVRGAVIGGTKHS NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtcactctctagctatgtaaacaagaaagttctaatcttaactgcggattcgagaacg ttggttggtacacttttaagttgtgatcagcagaccaatctggtcctatcccaaaccatt gagcgcataattagacctccagaagaccccgaagcctcgagtgaagtaccacacggcctt tatttgatccgcggtgacaatgtcgttgtagtagggcttgtggatgaggagctggatgat agtatcaactgggtggaggttaggggtgcggttatcggtgggacgaaacattcatga

DBGET integrated database retrieval system