Sclerotinia sclerotiorum: SS1G_13172 Help Entry SS1G_13172        CDS       T01071                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism ssl  Sclerotinia sclerotiorum Pathway ssl03060   Protein export ssl04141   Protein processing in endoplasmic reticulum ssl04145   Phagosome Brite KEGG Orthology (KO) [BR:ssl00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     SS1G_13172    04141 Protein processing in endoplasmic reticulum     SS1G_13172  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     SS1G_13172  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssl04131]     SS1G_13172   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ssl02044]     SS1G_13172 Membrane trafficking [BR:ssl04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     SS1G_13172 Secretion system [BR:ssl02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    SS1G_13172 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE UCR_Fe-S_N B12D Motif Other DBs NCBI-GeneID:  5482061 NCBI-ProteinID:  XP_001586079 UniProt:  A7F6E3 A0A1D9PXK1 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MADQIQEFMDVPKDFIKDGTQFINKCTKPDRREFINIARAVAMGFVIMGAVGYIVKLIHI PLNNILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atggcagaccaaattcaggagtttatggatgtcccaaaagactttatcaaagacggtact caattcatcaataaatgcacaaagcctgatcgtcgcgagttcatcaacatcgcccgagct gtcgctatgggatttgtcatcatgggcgccgtcggatatatcgtgaaattgattcatata ccactcaacaacatattggtcggtggcgcgtag

DBGET integrated database retrieval system