Sclerotinia sclerotiorum: SS1G_13183 Help Entry SS1G_13183        CDS       T01071                                  Name (RefSeq) hypothetical protein   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ssl  Sclerotinia sclerotiorum Pathway ssl04145   Phagosome ssl04148   Efferocytosis ssl04517   IgSF CAM signaling ssl04518   Integrin signaling ssl04620   Toll-like receptor signaling pathway ssl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ssl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     SS1G_13183    04518 Integrin signaling     SS1G_13183  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     SS1G_13183    04148 Efferocytosis     SS1G_13183  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     SS1G_13183  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     SS1G_13183  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssl04131]     SS1G_13183   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssl04147]     SS1G_13183    04031 GTP-binding proteins [BR:ssl04031]     SS1G_13183 Membrane trafficking [BR:ssl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     SS1G_13183  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     SS1G_13183   Macropinocytosis    Ras GTPases     SS1G_13183  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     SS1G_13183 Exosome [BR:ssl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SS1G_13183   Exosomal proteins of other body fluids (saliva and urine)    SS1G_13183   Exosomal proteins of colorectal cancer cells    SS1G_13183   Exosomal proteins of bladder cancer cells    SS1G_13183 GTP-binding proteins [BR:ssl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     SS1G_13183 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU MAM1 Motif Other DBs NCBI-GeneID:  5481969 NCBI-ProteinID:  XP_001586090 UniProt:  A7F6F4 LinkDB All DBs Position Unknown AA seq 196 aa AA seqDB search MAAPGTQSLKVRFIISLGNIDLMCVVTGDGAVGKVFLQFDNYSASVMVDGKPISLGLWDT AGQEDYDRLRPLSYPQTDVFLICFSIVSPPSFDNVRAKWFPEISHHAPGVPIILVGTKLD LRDDEPTKESLRSKRMEPVTYDQARVVAKEIRAHKYLECSALTQRNLKSVFDEAIRAVLS PQQQAPKPKKSKCIVL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atggcagcgccgggaactcaatccttaaaggtcagatttattatatctctgggaaatatt gatctcatgtgtgttgtgacaggagatggagctgttggcaaggtatttctccagttcgac aactattcggccagtgtgatggttgatgggaagccaataagccttggtttgtgggatact gctggacaagaggattacgacagactgcgcccactttcctatccacaaacagatgtattt ttgatttgcttttccattgtcagccctccatctttcgacaacgtcagagcaaagtggttt cccgaaatatcccatcatgcgcccggtgttccaatcattcttgtcggaacaaagttggat cttcgagatgatgagcctacgaaagaatctcttcgatccaaacgaatggagcctgtaacc tatgatcaggcaagagttgttgctaaagagatccgagcacacaaatacttagaatgttct gccctcacacaaagaaacctgaagagtgtgtttgatgaagcaatccgtgccgttctaagt ccgcaacaacaagcaccgaaaccaaagaagtccaagtgcatagttctatga

DBGET integrated database retrieval system