Sclerotinia sclerotiorum: SS1G_13726 Help Entry SS1G_13726        CDS       T01071                                  Name (RefSeq) hypothetical protein   KO K04393   cell division control protein 42 Organism ssl  Sclerotinia sclerotiorum Pathway ssl04011   MAPK signaling pathway - yeast ssl04144   Endocytosis ssl04517   IgSF CAM signaling ssl04518   Integrin signaling ssl05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ssl00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     SS1G_13726   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     SS1G_13726    04518 Integrin signaling     SS1G_13726  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     SS1G_13726  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     SS1G_13726  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ssl04131]     SS1G_13726    03036 Chromosome and associated proteins [BR:ssl03036]     SS1G_13726   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ssl04147]     SS1G_13726    04031 GTP-binding proteins [BR:ssl04031]     SS1G_13726 Membrane trafficking [BR:ssl04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     SS1G_13726  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     SS1G_13726   Macropinocytosis    Ras GTPases     SS1G_13726 Chromosome and associated proteins [BR:ssl03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     SS1G_13726 Exosome [BR:ssl04147]  Exosomal proteins   Exosomal proteins of microglial cells    SS1G_13726   Exosomal proteins of breast milk    SS1G_13726 GTP-binding proteins [BR:ssl04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     SS1G_13726 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  5481447 NCBI-ProteinID:  XP_001585487 UniProt:  A0A1D9QK08 A7F7Z6 LinkDB All DBs Position Unknown AA seq 194 aa AA seqDB search MVVATIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDT AGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEVHHHCPGVPCLIVGTQTD LRDDVSVKEKLTKQKMKPVEKSDGERMAKDLGAVKYVECSALTQYKLKDVFDEAIVAALE PPAPKKKQHRCLIL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggttgtcgcaacgataaaatgcgtcgtcgtcggtgatggtgccgtgggaaagacttgt ttactcatatcctatactaccaataaattcccttccgaatatgtccctacagttttcgat aactatgccgttacagttatgatcggcgatgaaccatataccctcggtctattcgatact gccgggcaagaggattatgacaggcttcgacccctctcatatccacaaaccgatgtcttc ctcgtttgcttctctgttacttcccccgcatcattcgagaacgtacgcgagaaatggttc ccagaggttcatcatcactgccctggtgtaccttgtttaatcgtgggcacacaaaccgat ttaagagatgatgttagtgtgaaggaaaagcttaccaaacaaaagatgaagccggttgag aagagtgatggtgaaagaatggctaaggatttgggggctgtcaaatacgtcgagtgtagt gctctgactcaatacaagctgaaggatgtcttcgatgaggccattgttgcggcattagaa cctcctgcgccaaagaagaaacaacatcgatgcttaattctttaa

DBGET integrated database retrieval system